"event" : "AcceptSolutionAction", }, } { } }, "event" : "MessagesWidgetCommentForm", "displayStyle" : "horizontal", { .attr('aria-selected','true'); "action" : "rerender" } "context" : "", "action" : "rerender" "event" : "MessagesWidgetEditAction", "action" : "rerender" { "actions" : [ "parameters" : { ] }, })(LITHIUM.jQuery); // Pull in global jQuery reference "triggerEvent" : "click", }, }, "parameters" : { LITHIUM.Dialog.options['501991284'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetMessageEdit", } "actions" : [ Port Forwarding Guides for FRITZ BOX . { "actions" : [ } { Wir zeigen Ihnen die verschiedenen Möglichkeiten, Verbindungen aus dem Internet entgegen zu nehmen. } } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "action" : "rerender" { { { }, "messageViewOptions" : "1111110111111111111110111110100101001101" ] "parameters" : { }, "context" : "envParam:entity", "useSubjectIcons" : "true", { "parameters" : { { { logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", "context" : "", }, "truncateBody" : "true", "event" : "removeThreadUserEmailSubscription", "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "actions" : [ } { count = 0; "event" : "approveMessage", ] }, ] "floatedBlock" : "acceptedSolutions", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bCGiwM8xQD-4LCTclzPOfvb9ZTg6J8OJJ7ua5WWJODg. "floatedBlock" : "acceptedSolutions", })(LITHIUM.jQuery); { { ] ] }, "componentId" : "forums.widget.message-view", "actions" : [ } "accessibility" : false, count = 0; element.siblings('li').children('ul').slideUp(); }, { Call of Duty oder die Chat-Funktion, muss die Spielekonsole jedoch … "disableLabelLinks" : "false", ] ] "actions" : [ "context" : "", { "actions" : [ ] "context" : "", }, } else { "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "event" : "AcceptSolutionAction", LITHIUM.Dialog.options['540369466'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "event" : "MessagesWidgetAnswerForm", { // We're good so far. } if ( key == neededkeys[0] ) { } "actions" : [ "action" : "rerender" }, "action" : "addClassName" LITHIUM.Dialog.options['354726278'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetEditAction", "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IlaQw7tvwWTD-YnxaaJR8pubZlJ_ldqMZNyb-uHE7ZY. { "event" : "removeThreadUserEmailSubscription", watching = false; }, }, "event" : "unapproveMessage", }, ] "context" : "", { "linkDisabled" : "false" "event" : "markAsSpamWithoutRedirect", "action" : "pulsate" "useSubjectIcons" : "true", "truncateBody" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ { } "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", { "parameters" : { }, "event" : "addMessageUserEmailSubscription", "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "truncateBody" : "true", "parameters" : { "context" : "envParam:quiltName", { // console.log(key); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "includeRepliesModerationState" : "false", { { "useTruncatedSubject" : "true", "context" : "envParam:entity", }); }); // Oops. }, ] } { { } }, "eventActions" : [ "action" : "rerender" { ', 'ajax'); { }, "initiatorDataMatcher" : "data-lia-kudos-id" } "context" : "", } "event" : "unapproveMessage", ] "actions" : [ } { "componentId" : "kudos.widget.button", }, "action" : "rerender" "}); { "disableKudosForAnonUser" : "false", "useSubjectIcons" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" ] ] "action" : "rerender" { { "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "event" : "approveMessage", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438621,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" } } "message" : "2438660", "event" : "MessagesWidgetEditAnswerForm", Bist du sicher, dass du fortfahren möchtest? "context" : "", ', 'ajax'); Der beste Service kann allerdings ins Stocken geraten, wenn … { }, "truncateBody" : "true", "context" : "", watching = false; ] "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "event" : "kudoEntity", "context" : "", }); "event" : "removeMessageUserEmailSubscription", }, "includeRepliesModerationState" : "false", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Die Xbox hat dann Zugang zum Internet und kann sich mit Online-Spielen verbinden oder für Chats mit Skype verwendet werden. "showCountOnly" : "false", "disableLinks" : "false", { } "parameters" : { "context" : "envParam:quiltName", "parameters" : { "parameters" : { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "disallowZeroCount" : "false", "useSubjectIcons" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ "useSubjectIcons" : "true", "includeRepliesModerationState" : "false", // console.log('watching: ' + key); }, "entity" : "2438510", "context" : "", "action" : "rerender" "event" : "addThreadUserEmailSubscription", }, "event" : "unapproveMessage", "action" : "pulsate" { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); }, { }, }, //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "event" : "ProductAnswerComment", } "action" : "rerender" "disableKudosForAnonUser" : "false", "action" : "rerender" } }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2437454}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438510}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438530}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438621}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438660}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438689}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507972}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507813}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507696}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507663}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507537}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507458}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507450}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507360}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507355}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507220}}]); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "event" : "RevokeSolutionAction", $(document).ready(function(){ { } "useCountToKudo" : "false", { "}); "action" : "rerender" "action" : "rerender" "actions" : [ "truncateBodyRetainsHtml" : "false", "actions" : [ "disallowZeroCount" : "false", "event" : "addMessageUserEmailSubscription", "action" : "rerender" { "componentId" : "forums.widget.message-view", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438530,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "useSubjectIcons" : "true", "action" : "rerender" "context" : "envParam:quiltName", LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "actions" : [ ] "event" : "AcceptSolutionAction", ] element.removeClass('active'); { "context" : "", { { "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_13c49cb906b8d2_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/159401&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetEditCommentForm", "event" : "ProductMessageEdit", ] "action" : "rerender" "entity" : "2437454", } }, } { { "event" : "removeMessageUserEmailSubscription", }, })(LITHIUM.jQuery); "event" : "kudoEntity", { "componentId" : "kudos.widget.button", { }, "action" : "rerender" "context" : "", }, count++; Xbox Live. "context" : "", ', 'ajax'); { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2437454}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438510}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438530}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438621}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438660}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438689}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507972}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507813}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507696}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507663}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507537}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507458}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507450}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507360}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507355}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507220}}]);