// If watching, pay attention to key presses, looking for right sequence. LITHIUM.AjaxSupport.useTickets = false; ] { $('.community-menu').removeClass('active') { "showCountOnly" : "false", } } LITHIUM.Dialog.options['1450496373'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "event" : "editProductMessage", "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,message", }, "event" : "ProductAnswer", }, })(LITHIUM.jQuery); }, "context" : "envParam:quiltName,message", "action" : "pulsate" }, { "event" : "RevokeSolutionAction", { ] "action" : "rerender" }); "componentId" : "forums.widget.message-view", { "context" : "", ] "action" : "rerender" notifCount = parseInt($(this).html()) + notifCount; { "actions" : [ "actions" : [ ] "context" : "", ] "truncateBody" : "true", "action" : "rerender" "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" var count = 0; "context" : "envParam:quiltName", { "actions" : [ "event" : "MessagesWidgetMessageEdit", "event" : "ProductAnswerComment", ] "truncateBody" : "true", "action" : "pulsate" }, }, "event" : "expandMessage", "useSimpleView" : "false", "event" : "QuickReply", "event" : "removeMessageUserEmailSubscription", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "useCountToKudo" : "false", } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:entity", "actions" : [ "event" : "MessagesWidgetEditAction", "disableLabelLinks" : "false", }, { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1664055 .lia-rating-control-passive', '#form_2'); "actions" : [ { "action" : "rerender" } "event" : "MessagesWidgetEditAnswerForm", { "selector" : "#kudosButtonV2_1", { { $(document).ready(function(){ "activecastFullscreen" : false, }, "actions" : [ Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:quiltName", "event" : "kudoEntity", }, ;(function($) { "action" : "rerender" }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, "kudosLinksDisabled" : "false", "context" : "envParam:quiltName,message", lithadmin: [] "action" : "rerender" LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); }, { "action" : "pulsate" "context" : "envParam:quiltName", { "displaySubject" : "true", ] { }, } LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "selector" : "#kudosButtonV2_2", "actions" : [ ] "kudosable" : "true", "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "actions" : [ ] { { } "useCountToKudo" : "false", { ] ] { $(document).ready(function(){ } else { "event" : "MessagesWidgetMessageEdit", "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'HjqKq0wSVDimNQSkTNGpeEsVVwzuhq3QDv50yQJdLAE. Bist du sicher, dass du fortfahren möchtest? "actions" : [ "event" : "MessagesWidgetMessageEdit", { }, "displaySubject" : "true", { "actions" : [ LITHIUM.Dialog({ "action" : "rerender" "action" : "rerender" "event" : "deleteMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1664101 .lia-rating-control-passive', '#form_4'); "actions" : [ { { { { "event" : "approveMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "event" : "AcceptSolutionAction", "context" : "envParam:selectedMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, "actions" : [ "context" : "", } { { }, { "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "MessagesWidgetCommentForm", "actions" : [ "action" : "rerender" "actions" : [ "actions" : [ { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'F6n79oEb97eCjf77JPAVylSU73X8pzv6RLDXHfEaBhA. } ] { "event" : "deleteMessage", } "event" : "addThreadUserEmailSubscription", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" var count = 0; { "includeRepliesModerationState" : "false", { }, "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-kudos-id" { ] { ] "actions" : [ { "context" : "envParam:selectedMessage", "parameters" : { "event" : "addThreadUserEmailSubscription", "truncateBody" : "true", "actions" : [ "action" : "rerender" ;(function($) { { "context" : "lia-deleted-state", }, "action" : "rerender" { "actions" : [ "eventActions" : [ "action" : "pulsate" { ] { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); ] "actions" : [ }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1664055,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. if ( key == neededkeys[0] ) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'bZG9H4VE7bChVL6QGOedO0ilNwSI_Izr1WZgteo4fBY. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ ] }); "actions" : [ } }, "context" : "", }, "action" : "rerender" "action" : "addClassName" { LITHIUM.AjaxSupport.ComponentEvents.set({ "selector" : "#messageview_1", }); "action" : "rerender" "action" : "rerender" { }, { { element.siblings('li').find('ul').slideUp(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "pulsate" { "kudosLinksDisabled" : "false", "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { }, "actions" : [ }); ] } "kudosable" : "true", "componentId" : "kudos.widget.button", { }, "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "initiatorBinding" : true, "actions" : [ { "initiatorBinding" : true, "useCountToKudo" : "false", ] "context" : "", }, { "useSubjectIcons" : "true", "truncateBody" : "true", "actions" : [ "action" : "rerender" "initiatorBinding" : true, "context" : "", { { { "event" : "MessagesWidgetEditAction", "componentId" : "forums.widget.message-view", "initiatorBinding" : true, "action" : "rerender" "action" : "rerender" { "context" : "", Klicken Sie danach auf die Schaltfläche "Jetzt Karte aufladen". LITHIUM.AjaxSupport.ComponentEvents.set({ return; $(document).ready(function(){ ] { "actions" : [ "includeRepliesModerationState" : "false", }, "dialogContentCssClass" : "lia-panel-dialog-content", }, "event" : "AcceptSolutionAction", Habe heute morgen um fünf Uhr eine Nachricht bekommen dass die Karte gesperrt wird wenn kein Guthaben aufgeladen wird Deswegen habe ich Heute um vier Uhr direkt Guthaben aufgeladen und wollte mir eine internetflat buchen das ging dann aber nicht weil da stand dass ich kein Guthaben habe obwohl bei der guthaben abfrage fünf Euro gesagt wird und in der app steht fünf Euro. { "action" : "rerender" "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); return; "dialogContentCssClass" : "lia-panel-dialog-content", ] "disableKudosForAnonUser" : "false", }, "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "action" : "rerender" "event" : "addMessageUserEmailSubscription", count++; ] "action" : "rerender" { "initiatorBinding" : true, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, $('#node-menu li.active').children('ul').show(); "context" : "lia-deleted-state", "actions" : [ { "event" : "MessagesWidgetCommentForm", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { { "actions" : [ "actions" : [ { "useTruncatedSubject" : "true", "actions" : [ "action" : "rerender" ], ] } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "removeThreadUserEmailSubscription", } // Oops, not the right sequence, lets restart from the top. } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ } "action" : "rerender" ] "context" : "", "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetEditAction", }, "event" : "removeThreadUserEmailSubscription", } "actions" : [ "action" : "rerender" }, { ', 'ajax'); "context" : "", { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", Da hilft nur eins - aufladen. ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "useSimpleView" : "false", "context" : "envParam:quiltName", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "context" : "", "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/46357","ajaxErrorEventName":"LITHIUM:ajaxError","token":"k6kCH5BU2aaKWN3DCe_yuNgSxiGDxOpy8H64szhlOqw. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); ] ] } "action" : "rerender" ] { }, "actions" : [ } Damit Kunden sich einen Überblick über das Verhalten von Vodafonebei Nichtnutzung oder fehlender Aufladung verschaffen kann, hier noch ein kurzer Exkurs zum inzwischen abgeschafften Kündigungsprozeß: Vodafone kündigte CallYa-Karten, wenn sie lange Zeit nicht mehr ins Vodafone-Netz eingebucht waren. } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/46357","ajaxErrorEventName":"LITHIUM:ajaxError","token":"S4w80sDmZCrunhP6NTB53OyvgJtgIPuWC_gP2xQ-QQE. }, "kudosable" : "true", { "action" : "rerender" { "selector" : "#kudosButtonV2_5", "displaySubject" : "true", "action" : "rerender" ] lithstudio: [], "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" }); "actions" : [ "event" : "ProductAnswer", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" ] } { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1664101 .lia-rating-control-passive', '#form_4'); "event" : "approveMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); } else { } { } "context" : "", }); "message" : "1664055", { } else { "initiatorDataMatcher" : "data-lia-message-uid" var key = e.keyCode; "disableLabelLinks" : "false", ] ] ] watching = false; } "actions" : [ .attr('aria-selected','false'); "actions" : [ { "eventActions" : [ })(LITHIUM.jQuery); { { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "", } "actions" : [ { }, { "actions" : [ } "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetCommentForm", }, "context" : "envParam:feedbackData", }, "event" : "editProductMessage", Re: Guthaben aufgeladen.. wird aber nicht angezeigt. "context" : "", } "event" : "RevokeSolutionAction", ] { }); } "truncateBody" : "true", } return; ;(function($) { })(LITHIUM.jQuery); // If watching, pay attention to key presses, looking for right sequence. }, "useCountToKudo" : "false", { }, "actions" : [ "action" : "pulsate" "action" : "rerender" "disableLinks" : "false", ] { "context" : "", "useSimpleView" : "false", "action" : "rerender" "actions" : [ }, })(LITHIUM.jQuery); }, { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } ], // Set start to true only if the first key in the sequence is pressed "actions" : [ "actions" : [ { }, } "disableLabelLinks" : "false", "action" : "addClassName" } "action" : "rerender" LITHIUM.Loader.runJsAttached(); "disableLinks" : "false", "parameters" : { "actions" : [ "revokeMode" : "true", "event" : "MessagesWidgetCommentForm", }, ] } } Öffnen Sie bei Vodafone das Menü CallYa-Karte aufladen". "actions" : [ "event" : "unapproveMessage", { { "action" : "rerender" "disallowZeroCount" : "false", } "context" : "", "action" : "rerender" "actions" : [ "parameters" : { ] "action" : "rerender" ] }, { "event" : "kudoEntity", } { { "disableKudosForAnonUser" : "false", ] ;(function($) { { }, }, "actions" : [ "context" : "", "context" : "envParam:selectedMessage", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'jdgvC-67bob6nnP7-OtKeXE7iLwcXaVc3UfZIjCPvvM. } "action" : "rerender" { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); var key = e.keyCode; "context" : "envParam:feedbackData", ], { } "action" : "rerender" "componentId" : "forums.widget.message-view", }, "disableKudosForAnonUser" : "false", }, "revokeMode" : "true", ;(function($) { { "disallowZeroCount" : "false", }, "displayStyle" : "horizontal", "actions" : [ return; "event" : "kudoEntity", ] { { }, { } "actions" : [ "action" : "rerender" } { "event" : "approveMessage", "entity" : "1664101", "initiatorBinding" : true, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1664101,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductAnswerComment", resetMenu(); LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { ] "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1663446,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductAnswerComment", "kudosable" : "true", "message" : "1663279", }, "context" : "envParam:quiltName", "context" : "", ] } "initiatorDataMatcher" : "data-lia-kudos-id" }, } { "context" : "envParam:quiltName,message,product,contextId,contextUrl", { { "event" : "unapproveMessage", { { "event" : "expandMessage", "action" : "rerender" { ', 'ajax'); "initiatorBinding" : true, "disallowZeroCount" : "false", ], "action" : "rerender" "context" : "", { "useSubjectIcons" : "true", }, ] ] }, "event" : "RevokeSolutionAction", { "disableKudosForAnonUser" : "false", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax'); } }, } { ] "displayStyle" : "horizontal", { "actions" : [ { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ $(this).toggleClass("view-btn-open view-btn-close"); { watching = false; }, "actions" : [ { "context" : "envParam:selectedMessage", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { ], "action" : "rerender" { } { }, { } "truncateBodyRetainsHtml" : "false", LITHIUM.Dialog({ } "action" : "rerender" "context" : "", if ( count == neededkeys.length ) { $(document).ready(function(){ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "action" : "rerender" } ] "action" : "rerender" "actions" : [ } "actions" : [ "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "defaultAriaLabel" : "", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" ] "event" : "editProductMessage", } "event" : "ProductAnswerComment", "context" : "", "context" : "envParam:selectedMessage", "selector" : "#messageview_3", "}); count = 0; ] }, } { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "context" : "envParam:quiltName,message", { } "context" : "", }, .attr('aria-expanded','false') { } "event" : "ProductAnswer", "actions" : [ "actions" : [ "actions" : [ "actions" : [ "event" : "ProductAnswer", }, }, // Oops, not the right sequence, lets restart from the top. "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/46357","ajaxErrorEventName":"LITHIUM:ajaxError","token":"S4w80sDmZCrunhP6NTB53OyvgJtgIPuWC_gP2xQ-QQE.