"actions" : [ "selector" : "#kudosButtonV2_5", "action" : "rerender" ] "actions" : [ } ', 'ajax'); Bevor du bei einer Signal-Störung in Panik gerätst und sie meldest, kannst du versuchen, sie selber zu beheben. "event" : "ProductAnswerComment", } "action" : "rerender" "context" : "", ] "disallowZeroCount" : "false", "useCountToKudo" : "false", { "kudosable" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ACN5jvb-n2QV6afdnHVuFctoHt7BDgP17745aDpQS6I. LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "entity" : "2436988", "useCountToKudo" : "false", ;(function($) { if ( neededkeys[count] == key ) { { "event" : "RevokeSolutionAction", "initiatorBinding" : true, "event" : "MessagesWidgetEditCommentForm", "truncateBody" : "true", "actions" : [ document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); { ], return; { "disallowZeroCount" : "false", "event" : "MessagesWidgetEditAction", "action" : "rerender" $(document).ready(function(){ { ] ] } "context" : "lia-deleted-state", } "event" : "kudoEntity", "actions" : [ "actions" : [ "action" : "rerender" { { return false; "action" : "rerender" "context" : "envParam:quiltName", "action" : "rerender" ] "context" : "", ] LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234019}); "actions" : [ ] "actions" : [ { "parameters" : { "actions" : [ "displaySubject" : "true", } return false; }; return; }, } "action" : "rerender" function setWarning(pagerId) { "context" : "", "actions" : [ Wir kümmern uns darum. LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "event" : "QuickReply", "event" : "MessagesWidgetEditAnswerForm", "message" : "2434714", { "actions" : [ "initiatorBinding" : true, "action" : "rerender" "context" : "envParam:quiltName", { }, { "action" : "pulsate" "accessibility" : false, "context" : "", }, "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/27182F110B8560C21A3CB35916861AA4/responsive_peak/images/button_dialog_close.svg", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_77a981f5ae59e1_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "envParam:entity", ] "event" : "ProductAnswerComment", }, "useTruncatedSubject" : "true", { LITHIUM.Dialog.options['-659190317'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "markAsSpamWithoutRedirect", "context" : "envParam:feedbackData", "useTruncatedSubject" : "true", }, } "displayStyle" : "horizontal", "event" : "expandMessage", "action" : "rerender" { { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.Dialog.options['444927579'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ ] Wir optimieren unsere E-Mail & Cloud Angebote. }, "event" : "MessagesWidgetEditAnswerForm", }, "componentId" : "forums.widget.message-view", }, ] "useSimpleView" : "false", function processPageInputBlur(pagerId, val) //var height = $(window).scrollTop(); { "componentId" : "kudos.widget.button", }); }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mVndhhvYCEOo6L4T38HZOB_IK0UmoaWTuLuaNWtT9fw. { }, { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ } { } LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); } } Vodafone hat zumindest für Essen eine Störung der DSL-Verbindungen bestätigt, ein generelles, bundesweites Problem scheint Vodafone derzeit in … "context" : "envParam:quiltName,message", "event" : "approveMessage", "disableLinks" : "false", disableInput(pagerId); }, })(LITHIUM.jQuery); // Pull in global jQuery reference $(document).ready(function(){ { }, ] } LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); { }, "action" : "rerender" { }, "event" : "MessagesWidgetMessageEdit", "actions" : [ { Du kannst auch Vodafone E-Mail mit POP3 und IMAP nutzen. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { }, LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } } { "context" : "", { { ;(function($) { function processPageInputBlur(pagerId, val) "kudosable" : "true", "context" : "", { LITHIUM.Dialog.options['-1040003818'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "useTruncatedSubject" : "true", LITHIUM.Dialog.options['-753422125'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "event" : "MessagesWidgetEditAction", "}); { { { { "event" : "unapproveMessage", "action" : "rerender" "event" : "addThreadUserEmailSubscription", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "disallowZeroCount" : "false", "truncateBodyRetainsHtml" : "false", "}); "actions" : [ "event" : "approveMessage", "actions" : [ }); ;(function($) { })(LITHIUM.jQuery); o.innerHTML = "Page number can\'t exceed 2. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", if ( count == neededkeys.length ) { { }, { "componentId" : "kudos.widget.button", } "context" : "envParam:selectedMessage", o.innerHTML = ""; Execute whatever should happen when entering the right sequence }, LITHIUM.Loader.runJsAttached(); } } })(LITHIUM.jQuery); "quiltName" : "ForumMessage", { } "disableLabelLinks" : "false", } "eventActions" : [ { "action" : "rerender" }, "useSimpleView" : "false", { { { "accessibility" : false, ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "actions" : [ } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "displaySubject" : "true", } { "actions" : [ LITHIUM.Loader.runJsAttached(); ', 'ajax'); ] "useTruncatedSubject" : "true", ] { "action" : "rerender" "action" : "rerender" }, } "context" : "", "action" : "rerender" ] "actions" : [ } { }, "action" : "rerender" }); { ] In meinem Fall sorgt es dafür, dass ich Video-Konferenzen so gut wie nicht machen kann, alle paar Sekunden höre ich nichts (weil UDP Pakete, die verloren gehen nicht wieder gesendet werden). LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2432564 .lia-rating-control-passive', '#form_1'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "actions" : [ "actions" : [ "showCountOnly" : "false", }); }, "action" : "rerender" }, { "}); ] { } "event" : "kudoEntity", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OfJZOhsEXCV6QMcHrO5f6YD6Z27Lpo6CgAA_dwebHAw. "context" : "envParam:selectedMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax'); "context" : "", "actions" : [ var key = e.keyCode; ] "actions" : [ "context" : "", "action" : "rerender" LITHIUM.Dialog({ Die E-MAILS wurden in der Vergangeheit automatisch empfangen und versandt. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); ] } }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TAXafxSdkskfExiNE-t9a5G_mFGvSs2WHap1EDWRayc. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "event" : "MessagesWidgetCommentForm", { } { "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'hhoK0hM63X1wmnhKMv35URRfiezy6yrxvJ1dXI8RaL4. "action" : "rerender" "disableKudosForAnonUser" : "false", } "context" : "", { "context" : "envParam:quiltName,product,contextId,contextUrl", Wenn du Vodafone eine Störung per Telefon melden willst, wende dich am besten an die Vodafone Hotline:. } ] } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2432493}},{"elementId":"link_9","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2432546}},{"elementId":"link_13","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2432564}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2433932}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2433958}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2434714}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2435249}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2436414}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2436988}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2439128}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2495862}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565828}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565724}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565665}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565632}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565564}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565485}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565414}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565384}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565375}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565369}}]); ] { { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TAXafxSdkskfExiNE-t9a5G_mFGvSs2WHap1EDWRayc. Damit erhalte ich jedoch selbst keine Antwort via E-Mail noch kann ich den E-Mail Verlauf verwenden um diesen im Nachgang an die relevanten Stellen weiterzuleiten. "action" : "rerender" }, "displaySubject" : "true", "quiltName" : "ForumMessage", Nutz einfach unsere Kontaktseite. ], "actions" : [ ] "event" : "markAsSpamWithoutRedirect", ] }; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", { "action" : "pulsate" "context" : "envParam:quiltName,message", }); "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" ;(function($) { } }, }, ] { LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "context" : "", ] "kudosLinksDisabled" : "false", { ] LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", element.siblings('li').find('li').removeClass('active'); { "componentId" : "kudos.widget.button", ] "context" : "envParam:quiltName", lithadmin: [] { { "initiatorBinding" : true, }, "context" : "envParam:feedbackData", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2434714,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.